PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn054881
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 286aa    MW: 31713.7 Da    PI: 9.4393
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn054881genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601352.8e-421132121100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r +a++slvyeA++r+rdPvyG++g i++lqqq+++l+ael+l+++
  Achn054881 113 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPESQRAEAVNSLVYEANMRLRDPVYGCMGAISALQQQVQSLQAELNLVRS 211
                 7***********************************************************************************************998 PP

      DUF260 100 e 100
                 e
  Achn054881 212 E 212
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.756112213IPR004883Lateral organ boundaries, LOB
PfamPF031953.3E-42113210IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MGMQFKAGAQ STDDVKAPSS RNLPWFNYLV IIVFCINRMI QGLALIDKVS SHGAIIWFMS  60
YSSPIYFGYL KFLRNMERFD EIGKKIKRDS DASIQMGRRY MVGSPRTLNI ITPCAACKLL  120
RRRCAQECPF SPYFSPHEPQ KFASVHKVFG ASNVSKMLME VPESQRAEAV NSLVYEANMR  180
LRDPVYGCMG AISALQQQVQ SLQAELNLVR SEILKFKYRE SDIIPSSHIS LFSSGIVSIA  240
APPAAPPPPP PPPLPPTLSS SLYSPLSTAT DYSTKANDQN VPYFG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279029.11e-104PREDICTED: LOB domain-containing protein 15
SwissprotQ8L5T57e-76LBD15_ARATH; LOB domain-containing protein 15
TrEMBLD7T4G01e-104D7T4G0_VITVI; Putative uncharacterized protein
STRINGVIT_13s0067g02380.t011e-104(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-76LOB domain-containing protein 15